Lineage for d1m8sa_ (1m8s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733099Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 2733102Domain d1m8sa_: 1m8s A: [78813]
    complexed with bu1, cd

Details for d1m8sa_

PDB Entry: 1m8s (more details), 1.9 Å

PDB Description: Crystal Structures of Cadmium-binding Acidic Phospholipase A2 from the Venom of Agkistrodon halys pallas at 1.9 Resolution (crystal grown at pH 5.9)
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1m8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8sa_ a.133.1.2 (A:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee
sepc

SCOPe Domain Coordinates for d1m8sa_:

Click to download the PDB-style file with coordinates for d1m8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1m8sa_: