| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
| Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
| Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
| Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
| Domain d1m8qe_: 1m8q E: [78799] |
PDB Entry: 1m8q (more details)
SCOP Domain Sequences for d1m8qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8qe_ i.15.1.1 (E:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda
Timeline for d1m8qe_: