Lineage for d1m8pc1 (1m8p C:1-170)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680390Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 680391Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 680407Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries)
  8. 680410Domain d1m8pc1: 1m8p C:1-170 [78783]
    Other proteins in same PDB: d1m8pa2, d1m8pa3, d1m8pb2, d1m8pb3, d1m8pc2, d1m8pc3
    complexed with pps

Details for d1m8pc1

PDB Entry: 1m8p (more details), 2.6 Å

PDB Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state
PDB Compounds: (C:) sulfate adenylyltransferase

SCOP Domain Sequences for d1m8pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8pc1 b.122.1.3 (C:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn
qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid
diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd

SCOP Domain Coordinates for d1m8pc1:

Click to download the PDB-style file with coordinates for d1m8pc1.
(The format of our PDB-style files is described here.)

Timeline for d1m8pc1: