Class b: All beta proteins [48724] (165 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (10 families) |
Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain |
Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries) |
Domain d1m8pc1: 1m8p C:1-170 [78783] Other proteins in same PDB: d1m8pa2, d1m8pa3, d1m8pb2, d1m8pb3, d1m8pc2, d1m8pc3 complexed with pps |
PDB Entry: 1m8p (more details), 2.6 Å
SCOP Domain Sequences for d1m8pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8pc1 b.122.1.3 (C:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd
Timeline for d1m8pc1: