Lineage for d1m8pb2 (1m8p B:171-390)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242231Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 242232Protein ATP sulfurylase central domain [63980] (3 species)
  7. 242244Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63982] (2 PDB entries)
  8. 242246Domain d1m8pb2: 1m8p B:171-390 [78781]
    Other proteins in same PDB: d1m8pa1, d1m8pa3, d1m8pb1, d1m8pb3, d1m8pc1, d1m8pc3

Details for d1m8pb2

PDB Entry: 1m8p (more details), 2.6 Å

PDB Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state

SCOP Domain Sequences for d1m8pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8pb2 c.26.1.5 (B:171-390) ATP sulfurylase central domain {Fungus (Penicillium chrysogenum)}
yvalrytpaelrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvglt
kpgdidhftrvrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfiv
grdhagpgsnskgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpa
gvktlnisgtelrrrlrsgahipewfsypevvkilresnp

SCOP Domain Coordinates for d1m8pb2:

Click to download the PDB-style file with coordinates for d1m8pb2.
(The format of our PDB-style files is described here.)

Timeline for d1m8pb2: