Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.2: An insect antifreeze protein [51177] (1 family) superhelical turns are made of three short strands |
Family b.81.2.1: An insect antifreeze protein [51178] (2 proteins) this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain |
Protein Thermal hysteresis protein [51179] (2 species) there are different numbers of superhelical turns (and sequence repeats) in different isoforms |
Species Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId:7141] [88690] (1 PDB entry) |
Domain d1m8nc_: 1m8n C: [78773] isoform 501 |
PDB Entry: 1m8n (more details), 2.45 Å
SCOPe Domain Sequences for d1m8nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8nc_ b.81.2.1 (C:) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 7-turn isoforms [TaxId: 7141]} tcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidksq vylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsam
Timeline for d1m8nc_: