Lineage for d1m8ma_ (1m8m A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796176Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 796177Species Chicken (Gallus gallus) [TaxId:9031] [50059] (21 PDB entries)
  8. 796195Domain d1m8ma_: 1m8m A: [78770]
    Solid-state MAS NMR structure

Details for d1m8ma_

PDB Entry: 1m8m (more details)

PDB Description: solid-state mas nmr structure of the a-spectrin sh3 domain
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOP Domain Sequences for d1m8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ma_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
elvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOP Domain Coordinates for d1m8ma_:

Click to download the PDB-style file with coordinates for d1m8ma_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ma_: