Lineage for d1m8ca_ (1m8c A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967729Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1967730Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1967731Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1967766Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 1967778Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (36 PDB entries)
  8. 1967810Domain d1m8ca_: 1m8c A: [78769]

Details for d1m8ca_

PDB Entry: 1m8c (more details)

PDB Description: solution structure of the t state of turkey ovomucoid at ph 2.5
PDB Compounds: (A:) Ovomucoid

SCOPe Domain Sequences for d1m8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ca_ g.68.1.1 (A:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
laavsvdcseypkdactleyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d1m8ca_:

Click to download the PDB-style file with coordinates for d1m8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ca_: