Lineage for d1m80b2 (1m80 B:96-357)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261944Fold d.128: Glutamine synthase/guanido kinase [55930] (1 superfamily)
  4. 261945Superfamily d.128.1: Glutamine synthase/guanido kinase [55931] (2 families) (S)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  5. 262048Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 262049Protein Arginine kinase, C-terminal domain [55942] (1 species)
  7. 262050Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (3 PDB entries)
  8. 262054Domain d1m80b2: 1m80 B:96-357 [78766]
    Other proteins in same PDB: d1m80a1, d1m80b1
    mutant

Details for d1m80b2

PDB Entry: 1m80 (more details), 2.35 Å

PDB Description: substrate free form of arginine kinase

SCOP Domain Sequences for d1m80b2:

Sequence, based on SEQRES records: (download)

>d1m80b2 d.128.1.2 (B:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

Sequence, based on observed residues (ATOM records): (download)

>d1m80b2 d.128.1.2 (B:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvgvydisnkrrlglteyqavremqdgil
emikmekaaa

SCOP Domain Coordinates for d1m80b2:

Click to download the PDB-style file with coordinates for d1m80b2.
(The format of our PDB-style files is described here.)

Timeline for d1m80b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m80b1