Lineage for d1m7za_ (1m7z A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337215Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 337216Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 337217Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 337218Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 337219Species Bacillus subtilis [TaxId:1423] [82822] (2 PDB entries)
  8. 337221Domain d1m7za_: 1m7z A: [78762]
    complexed with har, hem, thg

Details for d1m7za_

PDB Entry: 1m7z (more details), 2.14 Å

PDB Description: Structure of Nitric Oxide Synthase Heme Protein from Bacillus Subtilis with N-Hydroxy-Arginine and Tetrahydrofolate Bound

SCOP Domain Sequences for d1m7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7za_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis}
gshmeilwneakafiaecyqelgkeeevkdrldsikseidrtgsyvhtkeelehgakmaw
rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge
kqveiwnhqliryagyegerigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp
vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt
eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh
htaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkpy
e

SCOP Domain Coordinates for d1m7za_:

Click to download the PDB-style file with coordinates for d1m7za_.
(The format of our PDB-style files is described here.)

Timeline for d1m7za_: