Lineage for d1m7ya_ (1m7y A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247822Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 247823Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 248183Family c.67.1.4: omega-Aminoacid:pyruvate aminotransferase-like [53417] (13 proteins)
  6. 248184Protein 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) [53440] (2 species)
  7. 248185Species Apple (Malus domestica) [TaxId:3750] [53441] (2 PDB entries)
  8. 248186Domain d1m7ya_: 1m7y A: [78761]
    complexed with mpd, ppg

Details for d1m7ya_

PDB Entry: 1m7y (more details), 1.6 Å

PDB Description: Crystal structure of apple ACC synthase in complex with L-aminoethoxyvinylglycine

SCOP Domain Sequences for d1m7ya_:

Sequence, based on SEQRES records: (download)

>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica)}
mlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlakn
peaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagats
anetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeay
qeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafssps
fisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssf
glvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcw
vdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlam
qrlkafvgeyy

Sequence, based on observed residues (ATOM records): (download)

>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica)}
mlsrnatssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafk
kngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfif
cladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrn
lrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmev
lkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqt
qhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhll
rsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafv
geyy

SCOP Domain Coordinates for d1m7ya_:

Click to download the PDB-style file with coordinates for d1m7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ya_: