![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein 1,4-alpha-glucan branching enzyme [82179] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82180] (1 PDB entry) |
![]() | Domain d1m7xd2: 1m7x D:623-728 [78759] Other proteins in same PDB: d1m7xa1, d1m7xa3, d1m7xb1, d1m7xb3, d1m7xc1, d1m7xc3, d1m7xd1, d1m7xd3 |
PDB Entry: 1m7x (more details), 2.3 Å
SCOPe Domain Sequences for d1m7xd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7xd2 b.71.1.1 (D:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d1m7xd2: