Lineage for d1m7xc2 (1m7x C:623-728)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2076871Protein 1,4-alpha-glucan branching enzyme [82179] (1 species)
  7. 2076872Species Escherichia coli [TaxId:562] [82180] (1 PDB entry)
  8. 2076875Domain d1m7xc2: 1m7x C:623-728 [78756]
    Other proteins in same PDB: d1m7xa1, d1m7xa3, d1m7xb1, d1m7xb3, d1m7xc1, d1m7xc3, d1m7xd1, d1m7xd3

Details for d1m7xc2

PDB Entry: 1m7x (more details), 2.3 Å

PDB Description: the x-ray crystallographic structure of branching enzyme
PDB Compounds: (C:) 1,4-alpha-glucan Branching Enzyme

SCOPe Domain Sequences for d1m7xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7xc2 b.71.1.1 (C:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d1m7xc2:

Click to download the PDB-style file with coordinates for d1m7xc2.
(The format of our PDB-style files is described here.)

Timeline for d1m7xc2: