Lineage for d1m7xb3 (1m7x B:227-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081498Protein 1,4-alpha-glucan branching enzyme, central domain [82244] (1 species)
  7. 2081499Species Escherichia coli [TaxId:562] [82245] (1 PDB entry)
  8. 2081501Domain d1m7xb3: 1m7x B:227-622 [78754]
    Other proteins in same PDB: d1m7xa1, d1m7xa2, d1m7xb1, d1m7xb2, d1m7xc1, d1m7xc2, d1m7xd1, d1m7xd2

Details for d1m7xb3

PDB Entry: 1m7x (more details), 2.3 Å

PDB Description: The X-ray Crystallographic Structure of Branching Enzyme
PDB Compounds: (B:) 1,4-alpha-glucan Branching Enzyme

SCOPe Domain Sequences for d1m7xb3:

Sequence, based on SEQRES records: (download)

>d1m7xb3 c.1.8.1 (B:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvda
vasmiyrdysrkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgv
srpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshd
evvhgkksildrmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldw
hlleggdnwhhgvqrlvrdlnltyrhhkamheldfd

Sequence, based on observed residues (ATOM records): (download)

>d1m7xb3 c.1.8.1 (B:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrdipn
efggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgw
mhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawq
kfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrd
lnltyrhhkamheldfd

SCOPe Domain Coordinates for d1m7xb3:

Click to download the PDB-style file with coordinates for d1m7xb3.
(The format of our PDB-style files is described here.)

Timeline for d1m7xb3: