SCOPe 2.05: Domain d1m7xb1: 1m7x B:117-226

Lineage for d1m7xb1 (1m7x B:117-226)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein 1,4-alpha-glucan branching enzyme, N-terminal domain N [81962] (1 species)
   domain architecture similar to isoamylase

7. Species Escherichia coli [TaxId:562] [81963] (1 PDB entry)

8. Domain d1m7xb1: 1m7x B:117-226 [78752]
   Other proteins in same PDB: d1m7xa2, d1m7xa3, d1m7xb2, d1m7xb3, d1m7xc2, d1m7xc3, d1m7xd2, d1m7xd3

Details for d1m7xb1

PDB Entry: 1m7x, 2.3 Å

PDB Description: the x-ray crystallographic structure of branching enzyme

PDB Compounds: (B:) 1,4-alpha-glucan Branching Enzyme

SCOPe Domain Sequences for d1m7xb1:

Sequence, based on SEQRES records:

>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Sequence, based on observed residues (ATOM records):

>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqpetaslicglpek

Timeline for d1m7xb1:

• d1m7xb1 first appeared in SCOP 1.63
  
• d1m7xb1 appears in SCOPe 2.04
  
• d1m7xb1 appears in SCOPe 2.06
  
• d1m7xb1 appears in the current release, SCOPe 2.08