![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (17 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location |
![]() | Protein 1,4-alpha-glucan branching enzyme, N-terminal domain N [81962] (1 species) domain architecture similar to isoamylase |
![]() | Species Escherichia coli [TaxId:562] [81963] (1 PDB entry) |
![]() | Domain d1m7xb1: 1m7x B:117-226 [78752] Other proteins in same PDB: d1m7xa2, d1m7xa3, d1m7xb2, d1m7xb3, d1m7xc2, d1m7xc3, d1m7xd2, d1m7xd3 |
PDB Entry: 1m7x (more details), 2.3 Å
SCOP Domain Sequences for d1m7xb1:
Sequence, based on SEQRES records: (download)
>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqpetaslicglpek
Timeline for d1m7xb1: