Lineage for d1m7xb1 (1m7x B:117-226)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223309Protein 1,4-alpha-glucan branching enzyme, N-terminal domain N [81962] (1 species)
    domain architecture similar to isoamylase
  7. 223310Species Escherichia coli [TaxId:562] [81963] (1 PDB entry)
  8. 223312Domain d1m7xb1: 1m7x B:117-226 [78752]
    Other proteins in same PDB: d1m7xa2, d1m7xa3, d1m7xb2, d1m7xb3, d1m7xc2, d1m7xc3, d1m7xd2, d1m7xd3

Details for d1m7xb1

PDB Entry: 1m7x (more details), 2.3 Å

PDB Description: the x-ray crystallographic structure of branching enzyme

SCOP Domain Sequences for d1m7xb1:

Sequence, based on SEQRES records: (download)

>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Sequence, based on observed residues (ATOM records): (download)

>d1m7xb1 b.1.18.2 (B:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqpetaslicglpek

SCOP Domain Coordinates for d1m7xb1:

Click to download the PDB-style file with coordinates for d1m7xb1.
(The format of our PDB-style files is described here.)

Timeline for d1m7xb1: