Lineage for d1m7ta_ (1m7t A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699045Protein Thioredoxin [52835] (12 species)
  7. 699125Species Human (Homo sapiens) [TaxId:9606] [52842] (22 PDB entries)
  8. 699151Domain d1m7ta_: 1m7t A: [78745]
    human-escherichia coli thioredoxin chimera

Details for d1m7ta_

PDB Entry: 1m7t (more details)

PDB Description: solution structure and dynamics of the human-escherichia coli thioredoxin chimera: insights into thermodynamic stability
PDB Compounds: (A:) Chimera of Human and E. coli thioredoxin

SCOP Domain Sequences for d1m7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ta_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvapkygirgiptlllfkngevaatkvgalskgqlkefldanlv

SCOP Domain Coordinates for d1m7ta_:

Click to download the PDB-style file with coordinates for d1m7ta_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ta_: