Lineage for d1m7pb_ (1m7p B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078644Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2078684Domain d1m7pb_: 1m7p B: [78743]
    complexed with g3h

Details for d1m7pb_

PDB Entry: 1m7p (more details), 2.4 Å

PDB Description: Plasmodium Falciparum Triosephosphate isomerase (PfTIM) compled to substrate analog glycerol-3-phosphate (G3P).
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1m7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7pb_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOPe Domain Coordinates for d1m7pb_:

Click to download the PDB-style file with coordinates for d1m7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1m7pb_: