![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
![]() | Protein Triosephosphate isomerase [51353] (17 species) |
![]() | Species Plasmodium falciparum [51359] (9 PDB entries) |
![]() | Domain d1m7ob_: 1m7o B: [78741] complexed with 3pg |
PDB Entry: 1m7o (more details), 2.4 Å
SCOP Domain Sequences for d1m7ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7ob_ c.1.1.1 (B:) Triosephosphate isomerase {Plasmodium falciparum} rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd iiksam
Timeline for d1m7ob_: