Lineage for d1m7lc_ (1m7l C:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525083Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 525084Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 525156Protein Surfactant protein [57949] (2 species)
  7. 525157Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (4 PDB entries)
  8. 525169Domain d1m7lc_: 1m7l C: [78737]

Details for d1m7lc_

PDB Entry: 1m7l (more details)

PDB Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d

SCOP Domain Sequences for d1m7lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7lc_ h.1.1.1 (C:) Surfactant protein {Human (Homo sapiens), SP-D}
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi

SCOP Domain Coordinates for d1m7lc_:

Click to download the PDB-style file with coordinates for d1m7lc_.
(The format of our PDB-style files is described here.)

Timeline for d1m7lc_: