Lineage for d1m7hc_ (1m7h C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474612Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2474613Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 2474614Species Fungus (Penicillium chrysogenum) [TaxId:5076] [52574] (3 PDB entries)
  8. 2474621Domain d1m7hc_: 1m7h C: [78730]
    complexed with adp, adx, so4

Details for d1m7hc_

PDB Entry: 1m7h (more details), 2 Å

PDB Description: Crystal Structure of APS kinase from Penicillium Chrysogenum: Structure with APS soaked out of one dimer
PDB Compounds: (C:) Adenylylsulfate kinase

SCOPe Domain Sequences for d1m7hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7hc_ c.37.1.4 (C:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
tfhasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdni
rfglnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatp
geetglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpevhvkny
elpvqdavkqiidyldtkgylpak

SCOPe Domain Coordinates for d1m7hc_:

Click to download the PDB-style file with coordinates for d1m7hc_.
(The format of our PDB-style files is described here.)

Timeline for d1m7hc_: