Lineage for d1m7ha_ (1m7h A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123959Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2123960Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 2123961Species Fungus (Penicillium chrysogenum) [TaxId:5076] [52574] (3 PDB entries)
  8. 2123966Domain d1m7ha_: 1m7h A: [78728]
    complexed with adp, adx, so4

Details for d1m7ha_

PDB Entry: 1m7h (more details), 2 Å

PDB Description: Crystal Structure of APS kinase from Penicillium Chrysogenum: Structure with APS soaked out of one dimer
PDB Compounds: (A:) Adenylylsulfate kinase

SCOPe Domain Sequences for d1m7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ha_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
fhasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnir
fglnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpg
eetglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpevhvknye
lpvqdavkqiidyldtkgylpak

SCOPe Domain Coordinates for d1m7ha_:

Click to download the PDB-style file with coordinates for d1m7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ha_: