Lineage for d1m7ha_ (1m7h A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581731Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (1 protein)
  6. 581732Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (1 species)
  7. 581733Species Fungus (Penicillium chrysogenum) [TaxId:5076] [52574] (3 PDB entries)
  8. 581738Domain d1m7ha_: 1m7h A: [78728]

Details for d1m7ha_

PDB Entry: 1m7h (more details), 2 Å

PDB Description: Crystal Structure of APS kinase from Penicillium Chrysogenum: Structure with APS soaked out of one dimer

SCOP Domain Sequences for d1m7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ha_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum)}
fhasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnir
fglnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpg
eetglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpevhvknye
lpvqdavkqiidyldtkgylpak

SCOP Domain Coordinates for d1m7ha_:

Click to download the PDB-style file with coordinates for d1m7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ha_: