Lineage for d1m7gd_ (1m7g D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109870Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 protein domains)
    automatically mapped to Pfam PF01583
  6. 2109871Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 2109872Species Fungus (Penicillium chrysogenum) [TaxId:5076] [52574] (3 PDB entries)
  8. 2109876Domain d1m7gd_: 1m7g D: [78727]
    complexed with adp, adx, av2, gol, so4

Details for d1m7gd_

PDB Entry: 1m7g (more details), 1.43 Å

PDB Description: Crystal structure of APS kinase from Penicillium Chrysogenum: Ternary structure with ADP and APS
PDB Compounds: (D:) Adenylylsulfate kinase

SCOPe Domain Sequences for d1m7gd_:

Sequence, based on SEQRES records: (download)

>d1m7gd_ c.37.1.4 (D:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
kgylpak

Sequence, based on observed residues (ATOM records): (download)

>d1m7gd_ c.37.1.4 (D:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevattglpfvevyvdvpvevae
qrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgyl
pak

SCOPe Domain Coordinates for d1m7gd_:

Click to download the PDB-style file with coordinates for d1m7gd_.
(The format of our PDB-style files is described here.)

Timeline for d1m7gd_: