Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species) a pre-protein crosslinking domain inserted in the first AAA domain |
Species Bacillus subtilis [TaxId:1423] [82415] (4 PDB entries) Uniprot P28366 |
Domain d1m74a4: 1m74 A:396-570 [78723] Other proteins in same PDB: d1m74a1, d1m74a2 complexed with adp, mg, so4 |
PDB Entry: 1m74 (more details), 3 Å
SCOPe Domain Sequences for d1m74a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m74a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq
Timeline for d1m74a4: