![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species) a pre-protein crosslinking domain inserted in this first AAA domain |
![]() | Species Bacillus subtilis [TaxId:1423] [419442] (4 PDB entries) Uniprot P28366 |
![]() | Domain d1m74a3: 1m74 A:1-226,A:349-395 [78722] Other proteins in same PDB: d1m74a1, d1m74a2, d1m74a4 complexed with adp, mg, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m74 (more details), 3 Å
SCOPe Domain Sequences for d1m74a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m74a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Bacillus subtilis [TaxId: 1423]} mlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattdd llveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnalt gkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnel gfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqXsmtlatitfqnyf rmyeklagmtgtakteeeefrniynmqvvtiptn
Timeline for d1m74a3: