| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) ![]() automatically mapped to Pfam PF07516 |
| Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein) |
| Protein Helical scaffold and wing domains of SecA [81888] (3 species) |
| Species Bacillus subtilis [TaxId:1423] [81889] (4 PDB entries) Uniprot P28366 |
| Domain d1m74a2: 1m74 A:571-802 [78721] Other proteins in same PDB: d1m74a1, d1m74a3, d1m74a4 complexed with adp, mg, so4 |
PDB Entry: 1m74 (more details), 3 Å
SCOPe Domain Sequences for d1m74a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m74a2 a.172.1.1 (A:571-802) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]}
skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm
ikssleraiaaytpreelpeewkldglvdlinttyldegaleksdifgkepdemlelimd
riitkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplr
eyqmegfamfehmiesiedevakfvmkaeiennlereevvqgqttahqpqeg
Timeline for d1m74a2: