Lineage for d1m74a2 (1m74 A:571-802)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752608Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1752609Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
    automatically mapped to Pfam PF07516
  5. 1752610Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 1752611Protein Helical scaffold and wing domains of SecA [81888] (3 species)
  7. 1752612Species Bacillus subtilis [TaxId:1423] [81889] (4 PDB entries)
    Uniprot P28366
  8. 1752616Domain d1m74a2: 1m74 A:571-802 [78721]
    Other proteins in same PDB: d1m74a1, d1m74a3, d1m74a4
    complexed with adp, mg, so4

Details for d1m74a2

PDB Entry: 1m74 (more details), 3 Å

PDB Description: Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis
PDB Compounds: (A:) Preprotein translocase secA

SCOPe Domain Sequences for d1m74a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m74a2 a.172.1.1 (A:571-802) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]}
skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm
ikssleraiaaytpreelpeewkldglvdlinttyldegaleksdifgkepdemlelimd
riitkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplr
eyqmegfamfehmiesiedevakfvmkaeiennlereevvqgqttahqpqeg

SCOPe Domain Coordinates for d1m74a2:

Click to download the PDB-style file with coordinates for d1m74a2.
(The format of our PDB-style files is described here.)

Timeline for d1m74a2: