Lineage for d1m74a1 (1m74 A:227-348)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450074Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
    core: 4 helices: bundle; flanked by two short beta-hairpins
    duplication: consists of two structural repeats
  4. 450075Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) (S)
  5. 450076Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)
  6. 450077Protein Pre-protein crosslinking domain of SecA [81769] (2 species)
  7. 450078Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
  8. 450082Domain d1m74a1: 1m74 A:227-348 [78720]
    Other proteins in same PDB: d1m74a2, d1m74a3, d1m74a4

Details for d1m74a1

PDB Entry: 1m74 (more details), 3 Å

PDB Description: Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis

SCOP Domain Sequences for d1m74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m74a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

SCOP Domain Coordinates for d1m74a1:

Click to download the PDB-style file with coordinates for d1m74a1.
(The format of our PDB-style files is described here.)

Timeline for d1m74a1: