SCOPe 2.08: Domain d1m6yb2: 1m6y B:8-114,B:216-292

Lineage for d1m6yb2 (1m6y B:8-114,B:216-292)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein)

6. Protein TM0872, methyltransferase domain [82476] (2 species)
   contains an inserted alpha helical subdomain

7. Species Thermotoga maritima [TaxId:2336] [82477] (2 PDB entries)

8. Domain d1m6yb2: 1m6y B:8-114,B:216-292 [78719]
   Other proteins in same PDB: d1m6ya1, d1m6yb1
   CASP5
   complexed with sah, so4

Details for d1m6yb2

PDB Entry: 1m6y, 1.9 Å

PDB Description: crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sah

PDB Compounds: (B:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1m6yb2:

Sequence, based on SEQRES records:

>d1m6yb2 c.66.1.23 (B:8-114,B:216-292) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelenlkeflk
kaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseeeirenprarsgr
lraae

Sequence, based on observed residues (ATOM records):

>d1m6yb2 c.66.1.23 (B:8-114,B:216-292) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
hipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeek
lkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelenlkeflk
kaedllnpggrivvisfhsledrivketfrnskklriltekpvrpsprarsgrlraae

Timeline for d1m6yb2:

• d1m6yb2 first appeared in SCOP 1.63
  
• d1m6yb2 appears in SCOPe 2.07