Lineage for d1m6ya2 (1m6y A:2-114,A:216-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893541Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein)
  6. 2893542Protein TM0872, methyltransferase domain [82476] (2 species)
    contains an inserted alpha helical subdomain
  7. 2893543Species Thermotoga maritima [TaxId:2336] [82477] (2 PDB entries)
  8. 2893546Domain d1m6ya2: 1m6y A:2-114,A:216-294 [78717]
    Other proteins in same PDB: d1m6ya1, d1m6yb1
    CASP5
    complexed with sah, so4

Details for d1m6ya2

PDB Entry: 1m6y (more details), 1.9 Å

PDB Description: crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sah
PDB Compounds: (A:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1m6ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}
rkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevl
riaeeklkefsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgeXnrelen
lkeflkkaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseeeirenp
rarsgrlraaeri

SCOPe Domain Coordinates for d1m6ya2:

Click to download the PDB-style file with coordinates for d1m6ya2.
(The format of our PDB-style files is described here.)

Timeline for d1m6ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m6ya1