Lineage for d1m6xc1 (1m6x C:2-129)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999381Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1999382Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 protein domains)
  6. 1999433Protein Flp recombinase [47829] (1 species)
  7. 1999434Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
  8. 1999445Domain d1m6xc1: 1m6x C:2-129 [78712]
    Other proteins in same PDB: d1m6xa2, d1m6xb2, d1m6xc2, d1m6xd2
    protein/DNA complex

Details for d1m6xc1

PDB Entry: 1m6x (more details), 2.8 Å

PDB Description: Flpe-Holliday Junction Complex
PDB Compounds: (C:) flp recombinase

SCOPe Domain Sequences for d1m6xc1:

Sequence, based on SEQRES records: (download)

>d1m6xc1 a.60.9.1 (C:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
slqlqfes

Sequence, based on observed residues (ATOM records): (download)

>d1m6xc1 a.60.9.1 (C:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipynsditdivsslqlq
fes

SCOPe Domain Coordinates for d1m6xc1:

Click to download the PDB-style file with coordinates for d1m6xc1.
(The format of our PDB-style files is described here.)

Timeline for d1m6xc1: