SCOP 1.63: Domain d1m6ua_: 1m6u A:

Lineage for d1m6ua_ (1m6u A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (6 families)

5. Family b.2.5.7: DNA-binding domain from NDT80 [81992] (1 protein)

6. Protein DNA-binding domain from NDT80 [81993] (1 species)
   common fold is decorated with many additional structures

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81994] (4 PDB entries)

8. Domain d1m6ua_: 1m6u A: [78706]

Details for d1m6ua_

PDB Entry: 1m6u, 2.3 Å

PDB Description: Crystal Structure of a Novel DNA-binding domain from Ndt80, a Transcriptional Activator Required for Meiosis in Yeast

SCOP Domain Sequences for d1m6ua_:

Sequence; same for both SEQRES and ATOM records:

>d1m6ua_ b.2.5.7 (A:) DNA-binding domain from NDT80 {Baker's yeast (Saccharomyces cerevisiae)}
fkvgppfelvrdycpvveshtgrtldlriipridrgfdhideewvgykrnyftlvstfet
ancdldtflkssfdllvedssvesrlrvqyfaikikaknddddteinlvqhtakrdkgpq
fcpsvcplvpsplpkhqiireasnvrnitktkkydstfylhrnhvnyeeygvdsllfsyp
edsiqkvaryervqfassisvkkpfqqnkhfslhvilgavvdpdtfhgenpgipydelal
kngskgmfvylqemktppliirgrs

Timeline for d1m6ua_:

• d1m6ua_ is new in SCOP 1.63
  
• d1m6ua_ appears in SCOP 1.65
  
• d1m6ua_ appears in the current release, SCOPe 2.08