Lineage for d1m6ua_ (1m6u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768393Family b.2.5.7: DNA-binding domain from NDT80 [81992] (1 protein)
  6. 2768394Protein DNA-binding domain from NDT80 [81993] (1 species)
    common fold is decorated with many additional structures
  7. 2768395Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81994] (14 PDB entries)
  8. 2768407Domain d1m6ua_: 1m6u A: [78706]
    complexed with so4

Details for d1m6ua_

PDB Entry: 1m6u (more details), 2.3 Å

PDB Description: Crystal Structure of a Novel DNA-binding domain from Ndt80, a Transcriptional Activator Required for Meiosis in Yeast
PDB Compounds: (A:) NDT80 protein

SCOPe Domain Sequences for d1m6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ua_ b.2.5.7 (A:) DNA-binding domain from NDT80 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkvgppfelvrdycpvveshtgrtldlriipridrgfdhideewvgykrnyftlvstfet
ancdldtflkssfdllvedssvesrlrvqyfaikikaknddddteinlvqhtakrdkgpq
fcpsvcplvpsplpkhqiireasnvrnitktkkydstfylhrnhvnyeeygvdsllfsyp
edsiqkvaryervqfassisvkkpfqqnkhfslhvilgavvdpdtfhgenpgipydelal
kngskgmfvylqemktppliirgrs

SCOPe Domain Coordinates for d1m6ua_:

Click to download the PDB-style file with coordinates for d1m6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m6ua_: