Lineage for d1m6sc_ (1m6s C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866062Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1866356Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 1866360Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)
  8. 1866363Domain d1m6sc_: 1m6s C: [78703]
    complexed with ca, cl

Details for d1m6sc_

PDB Entry: 1m6s (more details), 1.8 Å

PDB Description: crystal structure of threonine aldolase
PDB Compounds: (C:) L-allo-threonine aldolase

SCOPe Domain Sequences for d1m6sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6sc_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOPe Domain Coordinates for d1m6sc_:

Click to download the PDB-style file with coordinates for d1m6sc_.
(The format of our PDB-style files is described here.)

Timeline for d1m6sc_: