Lineage for d1m6sc_ (1m6s C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318664Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 318665Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 318666Family c.67.1.1: AAT-like [53384] (7 proteins)
  6. 318860Protein Low-specificity threonine aldolase [64123] (1 species)
  7. 318861Species Thermatoga maritima [64124] (4 PDB entries)
  8. 318864Domain d1m6sc_: 1m6s C: [78703]

Details for d1m6sc_

PDB Entry: 1m6s (more details), 1.8 Å

PDB Description: crystal structure of threonine aldolase

SCOP Domain Sequences for d1m6sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6sc_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermatoga maritima}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOP Domain Coordinates for d1m6sc_:

Click to download the PDB-style file with coordinates for d1m6sc_.
(The format of our PDB-style files is described here.)

Timeline for d1m6sc_: