![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein Low-specificity threonine aldolase [64123] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries) |
![]() | Domain d1m6sa_: 1m6s A: [78701] Other proteins in same PDB: d1m6sd2 complexed with ca, cl |
PDB Entry: 1m6s (more details), 1.8 Å
SCOPe Domain Sequences for d1m6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d1m6sa_:
![]() Domains from other chains: (mouse over for more information) d1m6sb_, d1m6sc_, d1m6sd1, d1m6sd2 |