| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species) a pre-protein crosslinking domain inserted in the first AAA domain |
| Species Bacillus subtilis [TaxId:1423] [82415] (4 PDB entries) Uniprot P28366 |
| Domain d1m6na4: 1m6n A:396-570 [78700] Other proteins in same PDB: d1m6na1, d1m6na2 complexed with so4 |
PDB Entry: 1m6n (more details), 2.7 Å
SCOPe Domain Sequences for d1m6na4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6na4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}
rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip
hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes
rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq
Timeline for d1m6na4: