Lineage for d1m6na3 (1m6n A:1-226,A:349-395)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244087Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 244135Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (1 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 244136Species Bacillus subtilis [TaxId:1423] [82415] (2 PDB entries)
  8. 244137Domain d1m6na3: 1m6n A:1-226,A:349-395 [78699]
    Other proteins in same PDB: d1m6na1, d1m6na2

Details for d1m6na3

PDB Entry: 1m6n (more details), 2.7 Å

PDB Description: Crystal structure of the SecA translocation ATPase from Bacillus subtilis

SCOP Domain Sequences for d1m6na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6na3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis}
mlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattdd
llveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnalt
gkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnel
gfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqXsmtlatitfqnyf
rmyeklagmtgtakteeeefrniynmqvvtiptn

SCOP Domain Coordinates for d1m6na3:

Click to download the PDB-style file with coordinates for d1m6na3.
(The format of our PDB-style files is described here.)

Timeline for d1m6na3: