Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species) a pre-protein crosslinking domain inserted in this first AAA domain |
Species Bacillus subtilis [TaxId:1423] [419442] (4 PDB entries) Uniprot P28366 |
Domain d1m6na3: 1m6n A:1-226,A:349-395 [78699] Other proteins in same PDB: d1m6na1, d1m6na2, d1m6na4 complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m6n (more details), 2.7 Å
SCOPe Domain Sequences for d1m6na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6na3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Bacillus subtilis [TaxId: 1423]} mlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattdd llveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnalt gkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnel gfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqXsmtlatitfqnyf rmyeklagmtgtakteeeefrniynmqvvtiptn
Timeline for d1m6na3: