SCOPe 2.08: Domain d1m6na3: 1m6n A:1-226,A:349-395

Lineage for d1m6na3 (1m6n A:1-226,A:349-395)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species)
   a pre-protein crosslinking domain inserted in this first AAA domain

7. Species Bacillus subtilis [TaxId:1423] [419442] (4 PDB entries)
   Uniprot P28366

8. Domain d1m6na3: 1m6n A:1-226,A:349-395 [78699]
   Other proteins in same PDB: d1m6na1, d1m6na2, d1m6na4
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d1m6na3

PDB Entry: 1m6n, 2.7 Å

PDB Description: Crystal structure of the SecA translocation ATPase from Bacillus subtilis

PDB Compounds: (A:) Preprotein translocase secA

SCOPe Domain Sequences for d1m6na3:

Sequence; same for both SEQRES and ATOM records:

>d1m6na3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattdd
llveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnalt
gkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnel
gfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqXsmtlatitfqnyf
rmyeklagmtgtakteeeefrniynmqvvtiptn

Timeline for d1m6na3:

• d1m6na3 first appeared in SCOP 1.63
  
• d1m6na3 appears in SCOPe 2.07