Lineage for d1m6na1 (1m6n A:227-348)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348747Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
    core: 4 helices: bundle; flanked by two short beta-hairpins
    duplication: consists of two structural repeats
  4. 2348748Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) (S)
    automatically mapped to Pfam PF01043
  5. 2348749Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)
  6. 2348750Protein Pre-protein crosslinking domain of SecA [81769] (3 species)
  7. 2348751Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
    Uniprot P28366
  8. 2348753Domain d1m6na1: 1m6n A:227-348 [78697]
    Other proteins in same PDB: d1m6na2, d1m6na3, d1m6na4
    complexed with so4

Details for d1m6na1

PDB Entry: 1m6n (more details), 2.7 Å

PDB Description: Crystal structure of the SecA translocation ATPase from Bacillus subtilis
PDB Compounds: (A:) Preprotein translocase secA

SCOPe Domain Sequences for d1m6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6na1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

SCOPe Domain Coordinates for d1m6na1:

Click to download the PDB-style file with coordinates for d1m6na1.
(The format of our PDB-style files is described here.)

Timeline for d1m6na1: