Lineage for d1m6ja_ (1m6j A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 383643Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 383644Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 383645Protein Triosephosphate isomerase [51353] (16 species)
  7. 383646Species Amoeba (Entamoeba histolytica) [82236] (1 PDB entry)
  8. 383647Domain d1m6ja_: 1m6j A: [78693]

Details for d1m6ja_

PDB Entry: 1m6j (more details), 1.5 Å

PDB Description: crystal structure of triosephosphate isomerase from entamoeba histolytica

SCOP Domain Sequences for d1m6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Amoeba (Entamoeba histolytica)}
gagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilage
anganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekvk
vaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaigt
gktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflvg
gasldaakfktiinsvsekl

SCOP Domain Coordinates for d1m6ja_:

Click to download the PDB-style file with coordinates for d1m6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1m6ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m6jb_