Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries) |
Domain d1m66a2: 1m66 A:9-197 [78690] Other proteins in same PDB: d1m66a1 complexed with bcp, plm |
PDB Entry: 1m66 (more details), 1.9 Å
SCOP Domain Sequences for d1m66a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m66a2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana)} kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg drsfvcwat
Timeline for d1m66a2: