Lineage for d1m63c_ (1m63 C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379249Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 379250Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 379251Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 379258Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 379271Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 379345Domain d1m63c_: 1m63 C: [78679]
    Other proteins in same PDB: d1m63a_, d1m63b_, d1m63e_, d1m63f_

Details for d1m63c_

PDB Entry: 1m63 (more details), 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes

SCOP Domain Sequences for d1m63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m63c_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m63c_:

Click to download the PDB-style file with coordinates for d1m63c_.
(The format of our PDB-style files is described here.)

Timeline for d1m63c_: