Lineage for d1m5za_ (1m5z A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785926Protein Glutamate receptor interacting protein [82083] (2 species)
  7. 1785929Species Norway rat (Rattus norvegicus) [TaxId:10116] [82084] (3 PDB entries)
  8. 1785930Domain d1m5za_: 1m5z A: [78676]
    seventh PDZ domain

Details for d1m5za_

PDB Entry: 1m5z (more details)

PDB Description: the pdz7 of glutamate receptor interacting protein binds to its target via a novel hydrophobic surface area
PDB Compounds: (A:) AMPA receptor interacting protein

SCOPe Domain Sequences for d1m5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sptpvelhkvtlykdsgmedfgfsvadgllekgvyvknirpagpgdlgglkpydrllqvn
hvrtrdfdcclvvpliaesgnkldlvisrnp

SCOPe Domain Coordinates for d1m5za_:

Click to download the PDB-style file with coordinates for d1m5za_.
(The format of our PDB-style files is described here.)

Timeline for d1m5za_: