Lineage for d1m5yd1 (1m5y D:25-163,D:396-428)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780600Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 780601Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 780611Family a.223.1.2: Porin chaperone SurA, peptide-binding domain [81828] (1 protein)
  6. 780612Protein Porin chaperone SurA, peptide-binding domain [81829] (1 species)
  7. 780613Species Escherichia coli [TaxId:562] [81830] (2 PDB entries)
  8. 780617Domain d1m5yd1: 1m5y D:25-163,D:396-428 [78673]
    Other proteins in same PDB: d1m5ya2, d1m5ya3, d1m5yb2, d1m5yb3, d1m5yc2, d1m5yc3, d1m5yd2, d1m5yd3

Details for d1m5yd1

PDB Entry: 1m5y (more details), 3 Å

PDB Description: crystallographic structure of sura, a molecular chaperone that facilitates outer membrane porin folding
PDB Compounds: (D:) Survival protein surA

SCOP Domain Sequences for d1m5yd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5yd1 a.223.1.2 (D:25-163,D:396-428) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]}
vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
evrrritilpqeveslaqqXrayrmlmnrkfseeaaswmqeqrasayvkilsn

SCOP Domain Coordinates for d1m5yd1:

Click to download the PDB-style file with coordinates for d1m5yd1.
(The format of our PDB-style files is described here.)

Timeline for d1m5yd1: