Lineage for d1m5yc3 (1m5y C:283-385)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 501850Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 501851Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 501977Protein Porin chaperone SurA, PPIase domains [82624] (1 species)
  7. 501978Species Escherichia coli [TaxId:562] [82625] (1 PDB entry)
  8. 501984Domain d1m5yc3: 1m5y C:283-385 [78672]
    Other proteins in same PDB: d1m5ya1, d1m5yb1, d1m5yc1, d1m5yd1

Details for d1m5yc3

PDB Entry: 1m5y (more details), 3 Å

PDB Description: crystallographic structure of sura, a molecular chaperone that facilitates outer membrane porin folding

SCOP Domain Sequences for d1m5yc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5yc3 d.26.1.1 (C:283-385) Porin chaperone SurA, PPIase domains {Escherichia coli}
tevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdpgsanqggdlg
watpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrn

SCOP Domain Coordinates for d1m5yc3:

Click to download the PDB-style file with coordinates for d1m5yc3.
(The format of our PDB-style files is described here.)

Timeline for d1m5yc3: