Lineage for d1m5ya3 (1m5y A:279-386)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941556Protein Porin chaperone SurA, PPIase domains [82624] (1 species)
  7. 2941557Species Escherichia coli [TaxId:562] [82625] (4 PDB entries)
  8. 2941564Domain d1m5ya3: 1m5y A:279-386 [78666]
    Other proteins in same PDB: d1m5ya1, d1m5yb1, d1m5yc1, d1m5yd1
    has additional insertions and/or extensions that are not grouped together

Details for d1m5ya3

PDB Entry: 1m5y (more details), 3 Å

PDB Description: crystallographic structure of sura, a molecular chaperone that facilitates outer membrane porin folding
PDB Compounds: (A:) Survival protein surA

SCOPe Domain Sequences for d1m5ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]}
nisvtevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdpgsanqg
gdlgwatpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrnv

SCOPe Domain Coordinates for d1m5ya3:

Click to download the PDB-style file with coordinates for d1m5ya3.
(The format of our PDB-style files is described here.)

Timeline for d1m5ya3: