SCOP 1.65: Domain d1m5vf_: 1m5v F:

Lineage for d1m5vf_ (1m5v F:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (16 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries)

8. Domain d1m5vf_: 1m5v F: [78663]
   domain 1, complex with a ribozyme
   complexed with a23, ca, mpd; mutant

Details for d1m5vf_

PDB Entry: 1m5v, 2.4 Å

PDB Description: transition state stabilization by a catalytic rna

SCOP Domain Sequences for d1m5vf_:

Sequence; same for both SEQRES and ATOM records:

>d1m5vf_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d1m5vf_:

• d1m5vf_ first appeared in SCOP 1.63
  
• d1m5vf_ appears in SCOP 1.67
  
• d1m5vf_ appears in the current release, SCOPe 2.08