Lineage for d1m5ua_ (1m5u A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438296Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2438300Protein Cell division response regulator DivK [82342] (1 species)
  7. 2438301Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries)
  8. 2438304Domain d1m5ua_: 1m5u A: [78661]

Details for d1m5ua_

PDB Entry: 1m5u (more details), 1.87 Å

PDB Description: crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form
PDB Compounds: (A:) cell division response regulator DivK

SCOPe Domain Sequences for d1m5ua_:

Sequence, based on SEQRES records: (download)

>d1m5ua_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle
rqp

Sequence, based on observed residues (ATOM records): (download)

>d1m5ua_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtairggceayiskpisvvhfletikrllerqp

SCOPe Domain Coordinates for d1m5ua_:

Click to download the PDB-style file with coordinates for d1m5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ua_: