Lineage for d1m5ta_ (1m5t A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837708Protein Cell division response regulator DivK [82342] (1 species)
  7. 1837709Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries)
  8. 1837711Domain d1m5ta_: 1m5t A: [78660]

Details for d1m5ta_

PDB Entry: 1m5t (more details), 1.6 Å

PDB Description: crystal structure of the response regulator divk
PDB Compounds: (A:) cell division response regulator DivK

SCOPe Domain Sequences for d1m5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5ta_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle
rqp

SCOPe Domain Coordinates for d1m5ta_:

Click to download the PDB-style file with coordinates for d1m5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1m5ta_: